PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC8923_p2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family WOX
Protein Properties Length: 264aa    MW: 30289.2 Da    PI: 9.9588
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC8923_p2genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.92.6e-2191150357
                 --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
    Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                 +R+++t+eq+ +Le l++   r+p+a+++e+++++l    +++ ++V++WFqN++a+e++
  RrC8923_p2  91 TRWNPTQEQIGILEMLYKGgMRTPNAQQIEQITSQLgkygKIEGKNVFYWFQNHKARERQ 150
                 7*****************99**************************************97 PP

2Wus_type_Homeobox117.36.9e-3891152465
  Wus_type_Homeobox   4 tRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        tRW+Pt+eQi iLe+lyk G+rtPn+++i++it++L +yGkie+kNVfyWFQN+kaRerqkq
         RrC8923_p2  91 TRWNPTQEQIGILEMLYKGGMRTPNAQQIEQITSQLGKYGKIEGKNVFYWFQNHKARERQKQ 152
                        8***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.34986151IPR001356Homeobox domain
SuperFamilySSF466892.18E-1288155IPR009057Homeodomain-like
SMARTSM003891.3E-788155IPR001356Homeobox domain
CDDcd000866.86E-591152No hitNo description
PfamPF000465.2E-1991150IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.5E-892150IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 264 aa     Download sequence    Send to blast
MKVHEFSNGF SSWEQHDSPP SLSLSCKRLR PLAPKLSSSP CSPPPSSSGV TSATFDLKTF  60
IKPDQTCPRK FEYSIDHKRD LPQVETHSGG TRWNPTQEQI GILEMLYKGG MRTPNAQQIE  120
QITSQLGKYG KIEGKNVFYW FQNHKARERQ KQKRNNFISL SCQRSFKKTN INNTSVTTKT  180
TTTSSLEVIK FGLMFVQRDS MVEKGELVEE NEYKRTCRSW GFENLEIDSR RNINSSRNAT  240
MATTFNKIID NVTLELFPLY PEGR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013700837.11e-158PREDICTED: WUSCHEL-related homeobox 4-like
SwissprotQ6X7J91e-130WOX4_ARATH; WUSCHEL-related homeobox 4
TrEMBLA0A078FVV21e-159A0A078FVV2_BRANA; BnaA08g04100D protein
STRINGBra014055.1-P1e-155(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM59802747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G46480.11e-123WUSCHEL related homeobox 4